| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
Superfamily d.95.2: Homing endonucleases [55608] (3 families) ![]() |
| Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins) contains two extra helices in the C-terminal extension |
| Protein DNA endonuclease I-dmoI [55612] (1 species) duplication: contains tandem repeat of this fold |
| Species Desulfurococcus mobilis [TaxId:2274] [55613] (2 PDB entries) |
| Domain d1mowd2: 1mow D:505-599 [79363] Other proteins in same PDB: d1mowa1, d1mowd1, d1mowg1, d1mowj1 chimera of N-domain with I-CreI protein/DNA complex; complexed with gol, mg, so4 |
PDB Entry: 1mow (more details), 2.4 Å
SCOPe Domain Sequences for d1mowd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mowd2 d.95.2.1 (D:505-599) DNA endonuclease I-dmoI {Desulfurococcus mobilis [TaxId: 2274]}
envsgisayllgliwgdgglyklkykgnrseyrvvitqksenlikqfiaprmqflideln
vkskiqivkgdtryelrvsskklyyyfanmlerir
Timeline for d1mowd2: