Lineage for d1mowd2 (1mow D:505-599)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2572655Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 2572666Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 2572667Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
    contains two extra helices in the C-terminal extension
  6. 2572705Protein DNA endonuclease I-dmoI [55612] (1 species)
    duplication: contains tandem repeat of this fold
  7. 2572706Species Desulfurococcus mobilis [TaxId:2274] [55613] (2 PDB entries)
  8. 2572710Domain d1mowd2: 1mow D:505-599 [79363]
    Other proteins in same PDB: d1mowa1, d1mowd1, d1mowg1, d1mowj1
    chimera of N-domain with I-CreI
    protein/DNA complex; complexed with gol, mg, so4

Details for d1mowd2

PDB Entry: 1mow (more details), 2.4 Å

PDB Description: e-drei
PDB Compounds: (D:) chimera of homing endonuclease I-DmoI and DNA endonuclease I-CreI

SCOPe Domain Sequences for d1mowd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mowd2 d.95.2.1 (D:505-599) DNA endonuclease I-dmoI {Desulfurococcus mobilis [TaxId: 2274]}
envsgisayllgliwgdgglyklkykgnrseyrvvitqksenlikqfiaprmqflideln
vkskiqivkgdtryelrvsskklyyyfanmlerir

SCOPe Domain Coordinates for d1mowd2:

Click to download the PDB-style file with coordinates for d1mowd2.
(The format of our PDB-style files is described here.)

Timeline for d1mowd2: