Lineage for d1mowd2 (1mow D:505-599)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608385Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 608392Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 608393Family d.95.2.1: Group I mobile intron endonuclease [55609] (5 proteins)
    contains two extra helices in the C-terminal extension
  6. 608429Protein DNA endonuclease I-dmoI [55612] (1 species)
    duplication: contains tandem repeat of this fold
  7. 608430Species Archaeon Desulfurococcus mobilis [TaxId:2274] [55613] (2 PDB entries)
  8. 608434Domain d1mowd2: 1mow D:505-599 [79363]
    Other proteins in same PDB: d1mowa1, d1mowd1, d1mowg1, d1mowj1

Details for d1mowd2

PDB Entry: 1mow (more details), 2.4 Å

PDB Description: e-drei

SCOP Domain Sequences for d1mowd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mowd2 d.95.2.1 (D:505-599) DNA endonuclease I-dmoI {Archaeon Desulfurococcus mobilis}
envsgisayllgliwgdgglyklkykgnrseyrvvitqksenlikqfiaprmqflideln
vkskiqivkgdtryelrvsskklyyyfanmlerir

SCOP Domain Coordinates for d1mowd2:

Click to download the PDB-style file with coordinates for d1mowd2.
(The format of our PDB-style files is described here.)

Timeline for d1mowd2: