Lineage for d1mowa1 (1mow A:100-252)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1662475Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 1662486Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 1662487Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
    contains two extra helices in the C-terminal extension
  6. 1662494Protein DNA endonuclease I-CreI [55610] (1 species)
  7. 1662495Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [55611] (11 PDB entries)
    Uniprot P05725 2-154 ! Uniprot P05725
  8. 1662521Domain d1mowa1: 1mow A:100-252 [79360]
    Other proteins in same PDB: d1mowa2, d1mowd2, d1mowg2, d1mowj2
    chimera with the I-dmoI N-domain
    protein/DNA complex; complexed with gol, mg, so4

Details for d1mowa1

PDB Entry: 1mow (more details), 2.4 Å

PDB Description: e-drei
PDB Compounds: (A:) chimera of homing endonuclease I-DmoI and DNA endonuclease I-CreI

SCOPe Domain Sequences for d1mowa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mowa1 d.95.2.1 (A:100-252) DNA endonuclease I-CreI {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
lfngnrflaylagivdgdgsiiaqikpnqsykfkhqlsltfqvtqkterrwfldklvdei
gvgyvrdrgsvsdyilseikplhnfltqlqpflnfkqkqanlvlkiieqlpsakespdkf
levctwvdqiaalndsktrkttsetvravldsl

SCOPe Domain Coordinates for d1mowa1:

Click to download the PDB-style file with coordinates for d1mowa1.
(The format of our PDB-style files is described here.)

Timeline for d1mowa1: