Lineage for d1mokd3 (1mok D:384-523)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259657Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 259658Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 259659Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (10 proteins)
  6. 259742Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase [82726] (1 species)
  7. 259743Species Xanthobacter sp., py2 [TaxId:35809] [82727] (2 PDB entries)
  8. 259749Domain d1mokd3: 1mok D:384-523 [79358]
    Other proteins in same PDB: d1moka1, d1moka2, d1mokb1, d1mokb2, d1mokc1, d1mokc2, d1mokd1, d1mokd2
    complexed with fad

Details for d1mokd3

PDB Entry: 1mok (more details), 2.8 Å

PDB Description: nadph dependent 2-ketopropyl coenzyme m oxidoreductase/carboxylase

SCOP Domain Sequences for d1mokd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mokd3 d.87.1.1 (D:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2}
pknypdflhthyevsflgmgeeearaagheivtikmppdtenglnvalpasdrtmlyafg
kgtahmsgfqkividaktrkvlgahhvgygakdafqylnvlikqgltvdelgdmdelfln
pthfiqlsrlragsknlvsl

SCOP Domain Coordinates for d1mokd3:

Click to download the PDB-style file with coordinates for d1mokd3.
(The format of our PDB-style files is described here.)

Timeline for d1mokd3: