| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
| Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase, N- and C-terminal domain [418948] (1 species) |
| Species Xanthobacter sp., py2 [TaxId:35809] [419404] (5 PDB entries) |
| Domain d1mokc1: 1mok C:2-192,C:314-383 [79353] Other proteins in same PDB: d1moka2, d1moka3, d1mokb2, d1mokb3, d1mokc2, d1mokc3, d1mokd2, d1mokd3 complexed with fad has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1mok (more details), 2.8 Å
SCOPe Domain Sequences for d1mokc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mokc1 c.3.1.5 (C:2-192,C:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase, N- and C-terminal domain {Xanthobacter sp., py2 [TaxId: 35809]}
kvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsay
lramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvvg
ikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlila
vgagpgtldvpXeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpmem
fkarksgcyaarnvmgekisyt
Timeline for d1mokc1: