Lineage for d1mokb1 (1mok B:2-192,B:314-383)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase, N- and C-terminal domain [418948] (1 species)
  7. Species Xanthobacter sp., py2 [TaxId:35809] [419404] (5 PDB entries)
  8. Domain d1mokb1: 1mok B:2-192,B:314-383 [79350]
    Other proteins in same PDB: d1moka2, d1moka3, d1mokb2, d1mokb3, d1mokc2, d1mokc3, d1mokd2, d1mokd3
    complexed with fad
    has additional insertions and/or extensions that are not grouped together

Details for d1mokb1

PDB Entry: 1mok (more details), 2.8 Å

PDB Description: nadph dependent 2-ketopropyl coenzyme m oxidoreductase/carboxylase
PDB Compounds: (B:) orf3

SCOPe Domain Sequences for d1mokb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mokb1 c.3.1.5 (B:2-192,B:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase, N- and C-terminal domain {Xanthobacter sp., py2 [TaxId: 35809]}
kvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsay
lramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvvg
ikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlila
vgagpgtldvpXeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpmem
fkarksgcyaarnvmgekisyt

SCOPe Domain Coordinates for d1mokb1 are not available.

Timeline for d1mokb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mokb2, d1mokb3
View in 3D
Domains from other chains:
(mouse over for more information)
d1moka1, d1moka2, d1moka3, d1mokc1, d1mokc2, d1mokc3, d1mokd1, d1mokd2, d1mokd3