Lineage for d1mo9b3 (1mo9 B:384-523)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204289Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2204290Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2204291Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2204390Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase [82726] (1 species)
  7. 2204391Species Xanthobacter sp., py2 [TaxId:35809] [82727] (5 PDB entries)
  8. 2204393Domain d1mo9b3: 1mo9 B:384-523 [79346]
    Other proteins in same PDB: d1mo9a1, d1mo9a2, d1mo9b1, d1mo9b2
    complexed with fad, kpc

Details for d1mo9b3

PDB Entry: 1mo9 (more details), 1.65 Å

PDB Description: nadph dependent 2-ketopropyl coenzyme m oxidoreductase/carboxylase complexed with 2-ketopropyl coenzyme m
PDB Compounds: (B:) orf3

SCOPe Domain Sequences for d1mo9b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mo9b3 d.87.1.1 (B:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}
pknypdflhthyevsflgmgeeearaagheivtikmppdtenglnvalpasdrtmlyafg
kgtahmsgfqkividaktrkvlgahhvgygakdafqylnvlikqgltvdelgdmdelfln
pthfiqlsrlragsknlvsl

SCOPe Domain Coordinates for d1mo9b3:

Click to download the PDB-style file with coordinates for d1mo9b3.
(The format of our PDB-style files is described here.)

Timeline for d1mo9b3: