Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) both first two domains are of same beta/beta/alpha fold |
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase [82726] (1 species) |
Species Xanthobacter sp., py2 [TaxId:35809] [82727] (5 PDB entries) |
Domain d1mo9b3: 1mo9 B:384-523 [79346] Other proteins in same PDB: d1mo9a1, d1mo9a2, d1mo9b1, d1mo9b2 complexed with fad, kpc |
PDB Entry: 1mo9 (more details), 1.65 Å
SCOPe Domain Sequences for d1mo9b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mo9b3 d.87.1.1 (B:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} pknypdflhthyevsflgmgeeearaagheivtikmppdtenglnvalpasdrtmlyafg kgtahmsgfqkividaktrkvlgahhvgygakdafqylnvlikqgltvdelgdmdelfln pthfiqlsrlragsknlvsl
Timeline for d1mo9b3: