Lineage for d1mo9b2 (1mo9 B:193-313)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1833154Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 1833350Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase [82313] (1 species)
  7. 1833351Species Xanthobacter sp., py2 [TaxId:35809] [82314] (5 PDB entries)
  8. 1833355Domain d1mo9b2: 1mo9 B:193-313 [79345]
    Other proteins in same PDB: d1mo9a3, d1mo9b3
    complexed with fad, kpc

Details for d1mo9b2

PDB Entry: 1mo9 (more details), 1.65 Å

PDB Description: nadph dependent 2-ketopropyl coenzyme m oxidoreductase/carboxylase complexed with 2-ketopropyl coenzyme m
PDB Compounds: (B:) orf3

SCOPe Domain Sequences for d1mo9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mo9b2 c.3.1.5 (B:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}
gvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrtvmlvrteplkli
kdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpngemrietdfvflgl
g

SCOPe Domain Coordinates for d1mo9b2:

Click to download the PDB-style file with coordinates for d1mo9b2.
(The format of our PDB-style files is described here.)

Timeline for d1mo9b2: