Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase [82313] (1 species) |
Species Xanthobacter sp., py2 [TaxId:35809] [82314] (5 PDB entries) |
Domain d1mo9b2: 1mo9 B:193-313 [79345] Other proteins in same PDB: d1mo9a3, d1mo9b3 complexed with fad, kpc |
PDB Entry: 1mo9 (more details), 1.65 Å
SCOPe Domain Sequences for d1mo9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mo9b2 c.3.1.5 (B:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} gvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrtvmlvrteplkli kdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpngemrietdfvflgl g
Timeline for d1mo9b2: