Lineage for d1mo9b1 (1mo9 B:2-192,B:314-383)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 576286Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 576287Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 576622Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 576784Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase [82313] (1 species)
  7. 576785Species Xanthobacter sp., py2 [TaxId:35809] [82314] (2 PDB entries)
  8. 576788Domain d1mo9b1: 1mo9 B:2-192,B:314-383 [79344]
    Other proteins in same PDB: d1mo9a3, d1mo9b3

Details for d1mo9b1

PDB Entry: 1mo9 (more details), 1.65 Å

PDB Description: nadph dependent 2-ketopropyl coenzyme m oxidoreductase/carboxylase complexed with 2-ketopropyl coenzyme m

SCOP Domain Sequences for d1mo9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mo9b1 c.3.1.5 (B:2-192,B:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2}
kvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsay
lramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvvg
ikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlila
vgagpgtldvpXeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpmem
fkarksgcyaarnvmgekisyt

SCOP Domain Coordinates for d1mo9b1:

Click to download the PDB-style file with coordinates for d1mo9b1.
(The format of our PDB-style files is described here.)

Timeline for d1mo9b1: