Lineage for d1mo5a1 (1mo5 A:1-269)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243788Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (9 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 243947Protein RecA protein, ATPase-domain [52671] (2 species)
    C-terminal domain is alpha+beta
  7. 243951Species Mycobacterium tuberculosis [TaxId:1773] [52673] (6 PDB entries)
  8. 243955Domain d1mo5a1: 1mo5 A:1-269 [79337]
    Other proteins in same PDB: d1mo5a2
    complexed with sap

Details for d1mo5a1

PDB Entry: 1mo5 (more details), 3.25 Å

PDB Description: reca-atp-gamma-s-mg complex
PDB Compounds: (A:)

SCOP Domain Sequences for d1mo5a1:

Sequence, based on SEQRES records: (download)

>d1mo5a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis}
mtqtpdrekalelavaqieksygkgsvmrlgdearqpisviptgsialdvalgigglprg
rvieiygpessgkttvalhavanaqaaggvaafidaehaldpdyakklgvdtdsllvsqp
dtgeqaleiadmlirsgaldivvidsvaalvpraelegemgdshvglqarlmsqalrkmt
galnnsgttaifinqlrdkigvmfgspetttggkalkfyasvrmdvrrvetlkdgtnavg
nrtrvkvvknkclapfkqaefdilygkgi

Sequence, based on observed residues (ATOM records): (download)

>d1mo5a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis}
mtqtpdrekalelavaqieksygkgsvmrlgdearqpisviptgsialdvalgigglprg
rvieiygpessgkttvalhavanaqaaggvaafidaehaldpdyakklgvdtdsllvsqp
dtgeqaleiadmlirsgaldivvidsvaalvpraelegemgdshvglqarlmsqalrkmt
galnnsgttaifinqltttggkalkfyasvrmdvrrvetlkdgtnavgnrtrvkvvknkc
lapfkqaefdilygkgi

SCOP Domain Coordinates for d1mo5a1:

Click to download the PDB-style file with coordinates for d1mo5a1.
(The format of our PDB-style files is described here.)

Timeline for d1mo5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mo5a2