Lineage for d1mo4a2 (1mo4 A:270-329)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2514349Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 2514350Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) (S)
  5. 2514351Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 2514352Protein RecA protein, C-terminal domain [54754] (5 species)
  7. 2514373Species Mycobacterium tuberculosis [TaxId:1773] [54756] (6 PDB entries)
  8. 2514378Domain d1mo4a2: 1mo4 A:270-329 [79336]
    Other proteins in same PDB: d1mo4a1
    protein/DNA complex; complexed with ags

Details for d1mo4a2

PDB Entry: 1mo4 (more details), 3.2 Å

PDB Description: reca-atp-gamma-s complex
PDB Compounds: (A:) RecA

SCOPe Domain Sequences for d1mo4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mo4a2 d.48.1.1 (A:270-329) RecA protein, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
sregslidmgvdqglirksgawftyegeqlgqgkenarnflvenadvadeiekkikeklg

SCOPe Domain Coordinates for d1mo4a2:

Click to download the PDB-style file with coordinates for d1mo4a2.
(The format of our PDB-style files is described here.)

Timeline for d1mo4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mo4a1