Lineage for d1mo2b_ (1mo2 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135525Family c.69.1.22: Thioesterase domain of polypeptide, polyketide and fatty acid synthases [69584] (4 protein domains)
    Pfam PF00975
  6. 2135526Protein Erythromycin polyketide synthase [69585] (1 species)
    synonym: 6-deoxyerythronolide synthase
  7. 2135527Species Saccharopolyspora erythraea [TaxId:1836] [69586] (4 PDB entries)
  8. 2135531Domain d1mo2b_: 1mo2 B: [79332]

Details for d1mo2b_

PDB Entry: 1mo2 (more details), 3 Å

PDB Description: Thioesterase Domain from 6-Deoxyerythronolide Synthase (DEBS TE), pH 8.5
PDB Compounds: (B:) Erythronolide synthase, modules 5 and 6

SCOPe Domain Sequences for d1mo2b_:

Sequence, based on SEQRES records: (download)

>d1mo2b_ c.69.1.22 (B:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]}
gvsgrvrsyldllaglsdfrehfdgsdgfsldlvdmadgpgevtviccagtaaisgphef
trlagalrgiapvravpqpgyeegeplpssmaavaavqadavirtqgdkpfvvaghsaga
lmayalatelldrghpprgvvlidvyppghqdamnawleeltatlfdretvrmddtrlta
lgaydrltgqwrpretglptllvsagepmgpwpddswkptwpfehdtvavpgdhftmvqe
hadaiarhidawlgg

Sequence, based on observed residues (ATOM records): (download)

>d1mo2b_ c.69.1.22 (B:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]}
gvsgrvrsyldllaglsdfrehfdgsdgfsldlvdmadgpgevtviccagtaaisgphef
trlagalrgiapvravpqpgyeegeplpssmaavaavqadavirtqgdkpfvvaghsaga
lmayalatelldrghpprgvvlidvyppghqdamnawleeltatlfvrmddtrltalgay
drltgqwrpretglptllvsagepmgpwpddswkptwpfehdtvavpgdhftmvqehada
iarhidawlgg

SCOPe Domain Coordinates for d1mo2b_:

Click to download the PDB-style file with coordinates for d1mo2b_.
(The format of our PDB-style files is described here.)

Timeline for d1mo2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mo2a_