Lineage for d1mo0b_ (1mo0 B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 235646Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 235647Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 235648Protein Triosephosphate isomerase [51353] (15 species)
  7. 235714Species Nematode (Caenorhabditis elegans) [TaxId:6239] [82235] (1 PDB entry)
  8. 235716Domain d1mo0b_: 1mo0 B: [79330]
    structural genomics protein; complexed with act, so4

Details for d1mo0b_

PDB Entry: 1mo0 (more details), 1.7 Å

PDB Description: Structural Genomics Of Caenorhabditis Elegans: Triose Phosphate Isomerase
PDB Compounds: (B:)

SCOP Domain Sequences for d1mo0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mo0b_ c.1.1.1 (B:) Triosephosphate isomerase {Nematode (Caenorhabditis elegans)}
rkffvggnwkmngdyasvdgivtflnasadnssvdvvvappapylayaksklkagvlvaa
qncykvpkgaftgeispamikdlglewvilghserrhvfgesdaliaektvhaleagikv
vfcigekleereaghtkdvnfrqlqaivdkgvsweniviayepvwaigtgktasgeqaqe
vhewiraflkekvspavadatriiyggsvtadnaaelgkkpdidgflvggaslkpdfvki
inars

SCOP Domain Coordinates for d1mo0b_:

Click to download the PDB-style file with coordinates for d1mo0b_.
(The format of our PDB-style files is described here.)

Timeline for d1mo0b_: