![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) ![]() |
![]() | Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins) automatically mapped to Pfam PF00121 |
![]() | Protein Triosephosphate isomerase [51353] (21 species) |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [82235] (1 PDB entry) |
![]() | Domain d1mo0b_: 1mo0 B: [79330] Other proteins in same PDB: d1mo0a2 complexed with act, so4 |
PDB Entry: 1mo0 (more details), 1.7 Å
SCOPe Domain Sequences for d1mo0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mo0b_ c.1.1.1 (B:) Triosephosphate isomerase {Nematode (Caenorhabditis elegans) [TaxId: 6239]} rkffvggnwkmngdyasvdgivtflnasadnssvdvvvappapylayaksklkagvlvaa qncykvpkgaftgeispamikdlglewvilghserrhvfgesdaliaektvhaleagikv vfcigekleereaghtkdvnfrqlqaivdkgvsweniviayepvwaigtgktasgeqaqe vhewiraflkekvspavadatriiyggsvtadnaaelgkkpdidgflvggaslkpdfvki inars
Timeline for d1mo0b_: