Lineage for d1mo0b_ (1mo0 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413228Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2413229Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2413230Protein Triosephosphate isomerase [51353] (20 species)
  7. 2413392Species Nematode (Caenorhabditis elegans) [TaxId:6239] [82235] (1 PDB entry)
  8. 2413394Domain d1mo0b_: 1mo0 B: [79330]
    Other proteins in same PDB: d1mo0a2
    complexed with act, so4

Details for d1mo0b_

PDB Entry: 1mo0 (more details), 1.7 Å

PDB Description: Structural Genomics Of Caenorhabditis Elegans: Triose Phosphate Isomerase
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d1mo0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mo0b_ c.1.1.1 (B:) Triosephosphate isomerase {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
rkffvggnwkmngdyasvdgivtflnasadnssvdvvvappapylayaksklkagvlvaa
qncykvpkgaftgeispamikdlglewvilghserrhvfgesdaliaektvhaleagikv
vfcigekleereaghtkdvnfrqlqaivdkgvsweniviayepvwaigtgktasgeqaqe
vhewiraflkekvspavadatriiyggsvtadnaaelgkkpdidgflvggaslkpdfvki
inars

SCOPe Domain Coordinates for d1mo0b_:

Click to download the PDB-style file with coordinates for d1mo0b_.
(The format of our PDB-style files is described here.)

Timeline for d1mo0b_: