Lineage for d1mo0a_ (1mo0 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814175Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 814176Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 814177Protein Triosephosphate isomerase [51353] (18 species)
  7. 814258Species Nematode (Caenorhabditis elegans) [TaxId:6239] [82235] (1 PDB entry)
  8. 814259Domain d1mo0a_: 1mo0 A: [79329]

Details for d1mo0a_

PDB Entry: 1mo0 (more details), 1.7 Å

PDB Description: Structural Genomics Of Caenorhabditis Elegans: Triose Phosphate Isomerase
PDB Compounds: (A:) triosephosphate isomerase

SCOP Domain Sequences for d1mo0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mo0a_ c.1.1.1 (A:) Triosephosphate isomerase {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
stslykagltrkffvggnwkmngdyasvdgivtflnasadnssvdvvvappapylayaks
klkagvlvaaqncykvpkgaftgeispamikdlglewvilghserrhvfgesdaliaekt
vhaleagikvvfcigekleereaghtkdvnfrqlqaivdkgvsweniviayepvwaigtg
ktasgeqaqevhewiraflkekvspavadatriiyggsvtadnaaelgkkpdidgflvgg
aslkpdfvkiinarsta

SCOP Domain Coordinates for d1mo0a_:

Click to download the PDB-style file with coordinates for d1mo0a_.
(The format of our PDB-style files is described here.)

Timeline for d1mo0a_: