Lineage for d1mnya_ (1mny A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417732Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 417733Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (2 families) (S)
  5. 417734Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 417735Protein Cytochrome b5 [55858] (3 species)
  7. 417753Species Rat (Rattus norvegicus) [TaxId:10116] [55860] (20 PDB entries)
  8. 417781Domain d1mnya_: 1mny A: [79327]
    complexed with hdm

Details for d1mnya_

PDB Entry: 1mny (more details)

PDB Description: dimethyl propionate ester heme-containing cytochrome b5

SCOP Domain Sequences for d1mnya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnya_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus)}
dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
vghstdarelsktyiigelhpddrskiakpsetl

SCOP Domain Coordinates for d1mnya_:

Click to download the PDB-style file with coordinates for d1mnya_.
(The format of our PDB-style files is described here.)

Timeline for d1mnya_: