SCOPe 2.05: Domain d1mn8c_: 1mn8 C:

Lineage for d1mn8c_ (1mn8 C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.6: MMLV matrix protein-like [81803] (2 proteins)
   automatically mapped to Pfam PF01140

6. Protein MMLV matrix protein [81804] (1 species)

7. Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [81805] (1 PDB entry)

8. Domain d1mn8c_: 1mn8 C: [79320]
   the C-terminal helix region is missing

Details for d1mn8c_

PDB Entry: 1mn8, 1 Å

PDB Description: Structure of Moloney Murine Leukaemia Virus Matrix Protein

PDB Compounds: (C:) Core protein p15

SCOPe Domain Sequences for d1mn8c_:

Sequence; same for both SEQRES and ATOM records:

>d1mn8c_ a.61.1.6 (C:) MMLV matrix protein {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
vttplsltlghwkdveriahnqsvdvkkrrwvtfcsaewptfnvgwprdgtfnrdlitqv
kikvfspgphghpdqvpyivtwealafdpppwvk

Timeline for d1mn8c_:

• d1mn8c_ first appeared in SCOP 1.63
  
• d1mn8c_ appears in SCOPe 2.04
  
• d1mn8c_ appears in SCOPe 2.06
  
• d1mn8c_ appears in the current release, SCOPe 2.08