Lineage for d1mn8a_ (1mn8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002315Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 2002316Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 2002376Family a.61.1.6: MMLV matrix protein-like [81803] (2 proteins)
    automatically mapped to Pfam PF01140
  6. 2002377Protein MMLV matrix protein [81804] (1 species)
  7. 2002378Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [81805] (1 PDB entry)
  8. 2002379Domain d1mn8a_: 1mn8 A: [79318]
    the C-terminal helix region is missing

Details for d1mn8a_

PDB Entry: 1mn8 (more details), 1 Å

PDB Description: Structure of Moloney Murine Leukaemia Virus Matrix Protein
PDB Compounds: (A:) Core protein p15

SCOPe Domain Sequences for d1mn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mn8a_ a.61.1.6 (A:) MMLV matrix protein {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
qtvttplsltlghwkdveriahnqsvdvkkrrwvtfcsaewptfnvgwprdgtfnrdlit
qvkikvfspgphghpdqvpyivtwealafdpppwv

SCOPe Domain Coordinates for d1mn8a_:

Click to download the PDB-style file with coordinates for d1mn8a_.
(The format of our PDB-style files is described here.)

Timeline for d1mn8a_: