Class a: All alpha proteins [46456] (289 folds) |
Fold a.61: Retroviral matrix proteins [47835] (1 superfamily) 4-5 helices; right-handed superhelix |
Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) the 5th, C-terminal helix is missing in some of the member structures |
Family a.61.1.6: MMLV matrix protein-like [81803] (2 proteins) automatically mapped to Pfam PF01140 |
Protein MMLV matrix protein [81804] (1 species) |
Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [81805] (1 PDB entry) |
Domain d1mn8a_: 1mn8 A: [79318] the C-terminal helix region is missing |
PDB Entry: 1mn8 (more details), 1 Å
SCOPe Domain Sequences for d1mn8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mn8a_ a.61.1.6 (A:) MMLV matrix protein {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} qtvttplsltlghwkdveriahnqsvdvkkrrwvtfcsaewptfnvgwprdgtfnrdlit qvkikvfspgphghpdqvpyivtwealafdpppwv
Timeline for d1mn8a_: