Lineage for d1mn6b_ (1mn6 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135525Family c.69.1.22: Thioesterase domain of polypeptide, polyketide and fatty acid synthases [69584] (4 protein domains)
    Pfam PF00975
  6. 2135539Protein Picromycin polyketide synthase [82513] (1 species)
  7. 2135540Species Streptomyces venezuelae [TaxId:54571] [82514] (7 PDB entries)
  8. 2135552Domain d1mn6b_: 1mn6 B: [79315]

Details for d1mn6b_

PDB Entry: 1mn6 (more details), 2.2 Å

PDB Description: Thioesterase Domain from Picromycin Polyketide Synthase, pH 7.6
PDB Compounds: (B:) polyketide synthase IV

SCOPe Domain Sequences for d1mn6b_:

Sequence, based on SEQRES records: (download)

>d1mn6b_ c.69.1.22 (B:) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}
agmfralfrqaveddrygefldvlaeasafrpqfaspeacserldpvllaggptdraegr
avlvgctgtaanggpheflrlstsfqeerdflavplpgygtgtgtgtallpadldtalda
qarailraagdapvvllghsggallahelafrlerahgappagivlvdpyppghqepiev
wsrqlgeglfagelepmsdarllamgryarflagprpgrssapvllvraseplgdwqeer
gdwrahwdlphtvadvpgdhftmmrdhapavaeavlswldaie

Sequence, based on observed residues (ATOM records): (download)

>d1mn6b_ c.69.1.22 (B:) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}
agmfralfrqaveddrygefldvlaeasafrpqfaspeacserldpvllaggptdraegr
avlvgctgtaanggpheflrlstsfqeerdflavplpgyggtallpadldtaldaqarai
lraagdapvvllghsggallahelafrlerahgappagivlvdpyppghqepievwsrql
geglfagelepmsdarllamgryarflagprpgrssapvllvraseplgdwqeergdwra
hwdlphtvadvpgdhftmmrdhapavaeavlswldaie

SCOPe Domain Coordinates for d1mn6b_:

Click to download the PDB-style file with coordinates for d1mn6b_.
(The format of our PDB-style files is described here.)

Timeline for d1mn6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mn6a_