Class b: All beta proteins [48724] (149 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Elastase [50536] (4 species) |
Species Pig (Sus scrofa) [TaxId:9823] [50538] (59 PDB entries) |
Domain d1mmjn_: 1mmj N: [79302] complexed with ca, fr1, so4 |
PDB Entry: 1mmj (more details), 2.2 Å
SCOP Domain Sequences for d1mmjn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mmjn_ b.47.1.2 (N:) Elastase {Pig (Sus scrofa)} vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
Timeline for d1mmjn_: