Lineage for d1mmjn_ (1mmj N:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561477Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 561478Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 561609Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 561810Protein Elastase [50536] (4 species)
  7. 561822Species Pig (Sus scrofa) [TaxId:9823] [50538] (59 PDB entries)
  8. 561879Domain d1mmjn_: 1mmj N: [79302]
    complexed with ca, fr1, so4

Details for d1mmjn_

PDB Entry: 1mmj (more details), 2.2 Å

PDB Description: porcine pancreatic elastase complexed with a potent peptidyl inhibitor, fr136706

SCOP Domain Sequences for d1mmjn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmjn_ b.47.1.2 (N:) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d1mmjn_:

Click to download the PDB-style file with coordinates for d1mmjn_.
(The format of our PDB-style files is described here.)

Timeline for d1mmjn_: