Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
Superfamily f.4.1: OMPA-like [56925] (5 families) forms (8,10) barrel |
Family f.4.1.2: Outer membrane enzyme PagP [82874] (2 proteins) automatically mapped to Pfam PF07017 |
Protein Outer membrane enzyme PagP [82875] (1 species) |
Species Escherichia coli [TaxId:562] [82876] (3 PDB entries) Uniprot Q7C2L2 |
Domain d1mm4a1: 1mm4 A:2-162 [79294] Other proteins in same PDB: d1mm4a2, d1mm4a3 |
PDB Entry: 1mm4 (more details)
SCOPe Domain Sequences for d1mm4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mm4a1 f.4.1.2 (A:2-162) Outer membrane enzyme PagP {Escherichia coli [TaxId: 562]} nadewmttfreniaqtwqqpehydlyipaitwharfaydkektdrynerpwgggfglsrw dekgnwhglyamafkdswnkwepiagygwestwrpladenfhlglgftagvtardnwnyi plpvllplasvgygpvtfqmtyipgtynngnvyfawmrfqf
Timeline for d1mm4a1: