Lineage for d1mlyb_ (1mly B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247822Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 247823Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 248183Family c.67.1.4: omega-Aminoacid:pyruvate aminotransferase-like [53417] (13 proteins)
  6. 248207Protein Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA [53438] (1 species)
    synonym: 7,8-diaminopelargonic acid synthase
  7. 248208Species Escherichia coli [TaxId:562] [53439] (6 PDB entries)
  8. 248212Domain d1mlyb_: 1mly B: [79291]
    complexed with acz, na, plp

Details for d1mlyb_

PDB Entry: 1mly (more details), 1.81 Å

PDB Description: crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin

SCOP Domain Sequences for d1mlyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlyb_ c.67.1.4 (B:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli}
mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
vqdetffc

SCOP Domain Coordinates for d1mlyb_:

Click to download the PDB-style file with coordinates for d1mlyb_.
(The format of our PDB-style files is described here.)

Timeline for d1mlyb_: