Lineage for d1mlwa_ (1mlw A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004816Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 3004817Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 3004818Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 proteins)
  6. 3004855Protein Tryptophan hydroxylase [82826] (1 species)
  7. 3004856Species Human (Homo sapiens) [TaxId:9606] [82827] (4 PDB entries)
  8. 3004857Domain d1mlwa_: 1mlw A: [79289]
    complexed with fe, hbi

Details for d1mlwa_

PDB Entry: 1mlw (more details), 1.71 Å

PDB Description: Crystal structure of human tryptophan hydroxylase with bound 7,8-dihydro-L-biopterin cofactor and Fe(III)
PDB Compounds: (A:) Tryptophan 5-monooxygenase

SCOPe Domain Sequences for d1mlwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlwa_ d.178.1.1 (A:) Tryptophan hydroxylase {Human (Homo sapiens) [TaxId: 9606]}
svpwfpkkisdldhcanrvlmygseldadhpgfkdnvyrkrrkyfadlamnykhgdpipk
vefteeeiktwgtvfrelnklypthacreylknlpllskycgyrednipqledvsnflke
rtgfsirpvagylsprdflsglafrvfhctqyvrhssdpfytpepdtchellghvpllae
psfaqfsqeiglaslgaseeavqklatcyfftvefglckqdgqlrvfgagllssiselkh
alsghakvkpfdpkitckqeclittfqdvyfvsesfedakekmreftkti

SCOPe Domain Coordinates for d1mlwa_:

Click to download the PDB-style file with coordinates for d1mlwa_.
(The format of our PDB-style files is described here.)

Timeline for d1mlwa_: