Lineage for d1mlvc1 (1mlv C:311-487)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362212Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 362213Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) (S)
  5. 362214Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein)
  6. 362215Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species)
  7. 362216Species Garden pea (Pisum sativum) [TaxId:3888] [81825] (3 PDB entries)
  8. 362222Domain d1mlvc1: 1mlv C:311-487 [79287]
    Other proteins in same PDB: d1mlva2, d1mlvb2, d1mlvc2
    complexed with epe, sah

Details for d1mlvc1

PDB Entry: 1mlv (more details), 2.6 Å

PDB Description: structure and catalytic mechanism of a set domain protein methyltransferase

SCOP Domain Sequences for d1mlvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlvc1 a.166.1.1 (C:311-487) RuBisCo LSMT C-terminal, substrate-binding domain {Garden pea (Pisum sativum)}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdilenlyf

SCOP Domain Coordinates for d1mlvc1:

Click to download the PDB-style file with coordinates for d1mlvc1.
(The format of our PDB-style files is described here.)

Timeline for d1mlvc1: