Lineage for d1mlva1 (1mlv A:311-482)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348786Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 2348787Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) (S)
  5. 2348788Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein)
  6. 2348789Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species)
  7. 2348790Species Pea (Pisum sativum) [TaxId:3888] [81825] (7 PDB entries)
  8. 2348806Domain d1mlva1: 1mlv A:311-482 [79283]
    Other proteins in same PDB: d1mlva2, d1mlva3, d1mlvb2, d1mlvb3, d1mlvc2, d1mlvc3
    complexed with epe, sah

Details for d1mlva1

PDB Entry: 1mlv (more details), 2.6 Å

PDB Description: structure and catalytic mechanism of a set domain protein methyltransferase
PDB Compounds: (A:) Ribulose-1,5 biphosphate carboxylase/oxygenase large subunit N-methyltransferase

SCOPe Domain Sequences for d1mlva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlva1 a.166.1.1 (A:311-482) RuBisCo LSMT C-terminal, substrate-binding domain {Pea (Pisum sativum) [TaxId: 3888]}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdil

SCOPe Domain Coordinates for d1mlva1:

Click to download the PDB-style file with coordinates for d1mlva1.
(The format of our PDB-style files is described here.)

Timeline for d1mlva1: