SCOP 1.63: Domain d1mlva1: 1mlv A:311-486

Lineage for d1mlva1 (1mlv A:311-486)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily)
   multihelical; irregular array of long and short helices

4. Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family)

5. Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein)

6. Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [81825] (1 PDB entry)

8. Domain d1mlva1: 1mlv A:311-486 [79283]
   Other proteins in same PDB: d1mlva2, d1mlvb2, d1mlvc2

Details for d1mlva1

PDB Entry: 1mlv, 2.6 Å

PDB Description: structure and catalytic mechanism of a set domain protein methyltransferase

SCOP Domain Sequences for d1mlva1:

Sequence; same for both SEQRES and ATOM records:

>d1mlva1 a.166.1.1 (A:311-486) RuBisCo LSMT C-terminal, substrate-binding domain {Garden pea (Pisum sativum)}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdilenly

Timeline for d1mlva1:

• d1mlva1 is new in SCOP 1.63
  
• d1mlva1 appears in SCOP 1.65
  
• d1mlva1 appears in the current release, SCOPe 2.08