Lineage for d1ml9a_ (1ml9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818606Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
    Pfam PF00856
  5. 2818607Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
    contains metal-binding preSET (Pfam PF05033) or AWS (Associated With SET, Pfam PF17907), and postSET domains
  6. 2818608Protein Dim-5 [82201] (1 species)
  7. 2818609Species Fungus (Neurospora crassa) [TaxId:5141] [82202] (2 PDB entries)
  8. 2818610Domain d1ml9a_: 1ml9 A: [79282]
    complexed with unk, zn
    has additional insertions and/or extensions that are not grouped together

Details for d1ml9a_

PDB Entry: 1ml9 (more details), 1.98 Å

PDB Description: Structure of the Neurospora SET domain protein DIM-5, a histone lysine methyltransferase
PDB Compounds: (A:) Histone H3 methyltransferase DIM-5

SCOPe Domain Sequences for d1ml9a_:

Sequence, based on SEQRES records: (download)

>d1ml9a_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]}
qlpisivnreddaflnpnfrfidhsiigknvpvadqsfrvgcscasdeecmystcqclde
mapdsdeeadpytrkkrfayysqgakkgllrdrvlqsqepiyechqgcacskdcpnrvve
rgrtvplqifrtkdrgwgvkcpvnikrgqfvdrylgeiitseeadrrraestiarrkdvy
lfaldkfsdpdsldpllagqplevdgeymsgptrfinhscdpnmaifarvgdhadkhihd
lalfaikdipkgteltfdyvngltglesdahdpskisemtkclc

Sequence, based on observed residues (ATOM records): (download)

>d1ml9a_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]}
qlpisivnreddaflnpnfrfidhsiigknvpvadqsfrvgcscasdeecmystcqclde
mapdkrfayysqgakkgllrdrvlqsqepiyechqgcacskdcpnrvvergrtvplqifr
tkdrgwgvkcpvnikrgqfvdrylgeiitseeadrrraestiarrkdvylfaldkfsdpd
sldpllagqplevdgeymsgptrfinhscdpnmaifarvgdhadkhihdlalfaikdipk
gteltfdyvnkisemtkclc

SCOPe Domain Coordinates for d1ml9a_:

Click to download the PDB-style file with coordinates for d1ml9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ml9a_: