Lineage for d1ml5r_ (1ml5 R:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 753710Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 753711Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 753712Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 753713Protein 70S ribosome functional complex [58121] (3 species)
  7. 753759Species Escherichia coli [TaxId:562] [58123] (34 PDB entries)
  8. 754000Domain d1ml5r_: 1ml5 R: [79273]

Details for d1ml5r_

PDB Entry: 1ml5 (more details)

PDB Description: Structure of the E. coli ribosomal termination complex with release factor 2
PDB Compounds: (R:) 30S ribosomal protein S15

SCOP Domain Sequences for d1ml5r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml5r_ i.1.1.1 (R:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1ml5r_:

Click to download the PDB-style file with coordinates for d1ml5r_.
(The format of our PDB-style files is described here.)

Timeline for d1ml5r_: