Lineage for d1ml5m_ (1ml5 M:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3042559Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 3042943Domain d1ml5m_: 1ml5 M: [79268]
    also include low case chains a;b;c;d;e;f;g;h;l;m;n;o;p;q;r;s;t;u;v;w;x
    termination complex with release factor 2

Details for d1ml5m_

PDB Entry: 1ml5 (more details)

PDB Description: structure of the e. coli ribosomal termination complex with release factor 2
PDB Compounds: (M:) 30S ribosomal protein S10

SCOPe Domain Sequences for d1ml5m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml5m_ i.1.1.1 (M:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOPe Domain Coordinates for d1ml5m_:

Click to download the PDB-style file with coordinates for d1ml5m_.
(The format of our PDB-style files is described here.)

Timeline for d1ml5m_: