Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein 70S ribosome functional complex [58121] (4 species) |
Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
Domain d1ml5k_: 1ml5 K: [79266] also include low case chains a;b;c;d;e;f;g;h;l;m;n;o;p;q;r;s;t;u;v;w;x termination complex with release factor 2 |
PDB Entry: 1ml5 (more details), 14 Å
SCOPe Domain Sequences for d1ml5k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ml5k_ i.1.1.1 (K:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt drearklgvggelicevw
Timeline for d1ml5k_: