Lineage for d1ml5e_ (1ml5 E:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1970700Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 1970701Protein 70S ribosome functional complex [58121] (4 species)
  7. 1970702Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1970785Domain d1ml5e_: 1ml5 E: [79260]
    also include low case chains a;b;c;d;e;f;g;h;l;m;n;o;p;q;r;s;t;u;v;w;x
    termination complex with release factor 2

Details for d1ml5e_

PDB Entry: 1ml5 (more details), 14 Å

PDB Description: structure of the e. coli ribosomal termination complex with release factor 2
PDB Compounds: (E:) 30S ribosomal protein S2

SCOPe Domain Sequences for d1ml5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml5e_ i.1.1.1 (E:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOPe Domain Coordinates for d1ml5e_:

Click to download the PDB-style file with coordinates for d1ml5e_.
(The format of our PDB-style files is described here.)

Timeline for d1ml5e_: