SCOPe 2.07: Domain d1ml4a2: 1ml4 A:152-308

Lineage for d1ml4a2 (1ml4 A:152-308)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Pyrococcus abyssi [TaxId:29292] [82533] (1 PDB entry)

8. Domain d1ml4a2: 1ml4 A:152-308 [79256]
   complexed with pal

Details for d1ml4a2

PDB Entry: 1ml4, 1.8 Å

PDB Description: The PALA-liganded Aspartate transcarbamoylase catalytic subunit from Pyrococcus abyssi

PDB Compounds: (A:) aspartate transcarbamoylase

SCOPe Domain Sequences for d1ml4a2:

Sequence; same for both SEQRES and ATOM records:

>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Pyrococcus abyssi [TaxId: 29292]}
ridglkigllgdlkygrtvhslaealtfydvelylispellrmprhiveelrekgmkvve
tttledvigkldvlyvtriqkerfpdeqeylkvkgsyqvnlkvlekakdelrimhplprv
deihpevdntkhaiyfrqvfngvpvrmallalvlgvi

Timeline for d1ml4a2:

• d1ml4a2 first appeared in SCOP 1.63
  
• d1ml4a2 appears in SCOPe 2.06
  
• d1ml4a2 appears in the current release, SCOPe 2.08