Lineage for d1ml4a2 (1ml4 A:152-308)
- Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies)
consists of two similar domains related by pseudodyad; duplication
core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) 
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins) 
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (3 species) Species Archaeon Pyrococcus abyssi [TaxId:29292] [82533] (1 PDB entry) 
Domain d1ml4a2: 1ml4 A:152-308 [79256]
complexed with pal
Details for d1ml4a2
PDB Entry: 1ml4 (more details), 1.8 Å
PDB Description: The PALA-liganded Aspartate transcarbamoylase catalytic subunit from Pyrococcus abyssi
SCOP Domain Sequences for d1ml4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi}
ridglkigllgdlkygrtvhslaealtfydvelylispellrmprhiveelrekgmkvve
tttledvigkldvlyvtriqkerfpdeqeylkvkgsyqvnlkvlekakdelrimhplprv
deihpevdntkhaiyfrqvfngvpvrmallalvlgvi
SCOP Domain Coordinates for d1ml4a2:
Click to download the PDB-style file with coordinates for d1ml4a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ml4a2:
- d1ml4a2 is new in SCOP 1.63
- d1ml4a2 appears in SCOP 1.65
- d1ml4a2 appears in the current release, SCOPe 2.08
View in 3D
