Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.5: Probable GTPase Der, C-terminal domain [82653] (1 family) possible distant relative of the Era C-terminal domain lacking the KH motif |
Family d.52.5.1: Probable GTPase Der, C-terminal domain [82654] (1 protein) |
Protein Probable GTPase Der, C-terminal domain [82655] (1 species) |
Species Thermotoga maritima [TaxId:2336] [82656] (1 PDB entry) |
Domain d1mkya3: 1mky A:359-439 [79252] Other proteins in same PDB: d1mkya1, d1mkya2 complexed with gdp, po4 |
PDB Entry: 1mky (more details), 1.9 Å
SCOPe Domain Sequences for d1mkya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mkya3 d.52.5.1 (A:359-439) Probable GTPase Der, C-terminal domain {Thermotoga maritima [TaxId: 2336]} kvpssainsalqkvlaftnlprglkiffgvqvdikpptflffvnsiekvknpqkiflrkl irdyvfpfegspiflkfkrsr
Timeline for d1mkya3: