SCOP 1.63: Domain d1mkmb2: 1mkm B:76-246

Lineage for d1mkmb2 (1mkm B:76-246)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.110: Profilin-like [55769] (5 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (2 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.2: Thanscriptional regulator IclR, C-terminal domain [75513] (1 protein)

6. Protein Thanscriptional regulator IclR, C-terminal domain [75514] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [75515] (1 PDB entry)

8. Domain d1mkmb2: 1mkm B:76-246 [79245]
   Other proteins in same PDB: d1mkma1, d1mkmb1
   structural genomics protein; complexed with fmt, zn

Details for d1mkmb2

PDB Entry: 1mkm, 2.2 Å

PDB Description: crystal structure of the thermotoga maritima iclr

SCOP Domain Sequences for d1mkmb2:

Sequence; same for both SEQRES and ATOM records:

>d1mkmb2 d.110.2.2 (B:76-246) Thanscriptional regulator IclR, C-terminal domain {Thermotoga maritima}
nirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqsipmvsrlgmkvdlystas
gksilafvpekelkeylkivelkpktpntitnprvlkrelekirkrgyavdneeneigim
cvgvpifdhngypvagvsisgvarkfteekieeysdvlkekaeeisrklgy

Timeline for d1mkmb2:

• d1mkmb2 is new in SCOP 1.63
  
• d1mkmb2 appears in SCOP 1.65
  
• d1mkmb2 appears in the current release, SCOPe 2.08