Lineage for d1mkmb1 (1mkm B:0-75)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722365Family a.4.5.33: Transcriptional regulator IclR, N-terminal domain [74676] (1 protein)
  6. 1722366Protein Transcriptional regulator IclR, N-terminal domain [74677] (1 species)
  7. 1722367Species Thermotoga maritima [TaxId:2336] [74678] (1 PDB entry)
  8. 1722369Domain d1mkmb1: 1mkm B:0-75 [79244]
    Other proteins in same PDB: d1mkma2, d1mkmb2
    complexed with fmt, zn

Details for d1mkmb1

PDB Entry: 1mkm (more details), 2.2 Å

PDB Description: crystal structure of the thermotoga maritima iclr
PDB Compounds: (B:) IclR transcriptional regulator

SCOPe Domain Sequences for d1mkmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkmb1 a.4.5.33 (B:0-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
hmntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkryv
pgyklieygsfvlrrf

SCOPe Domain Coordinates for d1mkmb1:

Click to download the PDB-style file with coordinates for d1mkmb1.
(The format of our PDB-style files is described here.)

Timeline for d1mkmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mkmb2