SCOP 1.75: Domain d1mkmb1: 1mkm B:0-75

Lineage for d1mkmb1 (1mkm B:0-75)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.33: Transcriptional regulator IclR, N-terminal domain [74676] (1 protein)

6. Protein Transcriptional regulator IclR, N-terminal domain [74677] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [74678] (1 PDB entry)

8. Domain d1mkmb1: 1mkm B:0-75 [79244]
   Other proteins in same PDB: d1mkma2, d1mkmb2
   complexed with fmt, zn

Details for d1mkmb1

PDB Entry: 1mkm, 2.2 Å

PDB Description: crystal structure of the thermotoga maritima iclr

PDB Compounds: (B:) IclR transcriptional regulator

SCOP Domain Sequences for d1mkmb1:

Sequence; same for both SEQRES and ATOM records:

>d1mkmb1 a.4.5.33 (B:0-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
hmntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkryv
pgyklieygsfvlrrf

Timeline for d1mkmb1:

• d1mkmb1 first appeared in SCOP 1.63
  
• d1mkmb1 appears in SCOP 1.73
  
• d1mkmb1 appears in SCOPe 2.01
  
• d1mkmb1 appears in the current release, SCOPe 2.08