![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.2: GAF domain-like [55781] (5 families) ![]() alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
![]() | Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins) Pfam PF01614 |
![]() | Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [75515] (1 PDB entry) |
![]() | Domain d1mkma2: 1mkm A:76-246 [79243] Other proteins in same PDB: d1mkma1, d1mkmb1 complexed with fmt, zn |
PDB Entry: 1mkm (more details), 2.2 Å
SCOPe Domain Sequences for d1mkma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mkma2 d.110.2.2 (A:76-246) Transcriptional regulator IclR, C-terminal domain {Thermotoga maritima [TaxId: 2336]} nirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqsipmvsrlgmkvdlystas gksilafvpekelkeylkivelkpktpntitnprvlkrelekirkrgyavdneeneigim cvgvpifdhngypvagvsisgvarkfteekieeysdvlkekaeeisrklgy
Timeline for d1mkma2: