Lineage for d1mkma2 (1mkm A:76-246)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509664Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 509706Superfamily d.110.2: GAF domain-like [55781] (3 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 509720Family d.110.2.2: IclR ligand-binding domain-like (Pfam 01614) [75513] (2 proteins)
  6. 509727Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species)
  7. 509733Species Thermotoga maritima [TaxId:243274] [75515] (1 PDB entry)
  8. 509734Domain d1mkma2: 1mkm A:76-246 [79243]
    Other proteins in same PDB: d1mkma1, d1mkmb1

Details for d1mkma2

PDB Entry: 1mkm (more details), 2.2 Å

PDB Description: crystal structure of the thermotoga maritima iclr

SCOP Domain Sequences for d1mkma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkma2 d.110.2.2 (A:76-246) Transcriptional regulator IclR, C-terminal domain {Thermotoga maritima}
nirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqsipmvsrlgmkvdlystas
gksilafvpekelkeylkivelkpktpntitnprvlkrelekirkrgyavdneeneigim
cvgvpifdhngypvagvsisgvarkfteekieeysdvlkekaeeisrklgy

SCOP Domain Coordinates for d1mkma2:

Click to download the PDB-style file with coordinates for d1mkma2.
(The format of our PDB-style files is described here.)

Timeline for d1mkma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mkma1