SCOPe 2.08: Domain d1mkma2: 1mkm A:76-246

Lineage for d1mkma2 (1mkm A:76-246)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
   Pfam PF01614

6. Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [75515] (2 PDB entries)

8. Domain d1mkma2: 1mkm A:76-246 [79243]
   Other proteins in same PDB: d1mkma1, d1mkmb1, d1mkmb3
   complexed with fmt, zn

Details for d1mkma2

PDB Entry: 1mkm, 2.2 Å

PDB Description: crystal structure of the thermotoga maritima iclr

PDB Compounds: (A:) IclR transcriptional regulator

SCOPe Domain Sequences for d1mkma2:

Sequence; same for both SEQRES and ATOM records:

>d1mkma2 d.110.2.2 (A:76-246) Transcriptional regulator IclR, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
nirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqsipmvsrlgmkvdlystas
gksilafvpekelkeylkivelkpktpntitnprvlkrelekirkrgyavdneeneigim
cvgvpifdhngypvagvsisgvarkfteekieeysdvlkekaeeisrklgy

Timeline for d1mkma2:

• d1mkma2 first appeared in SCOP 1.63
  
• d1mkma2 appears in SCOPe 2.07