SCOPe 2.05: Domain d1mkma1: 1mkm A:1-75

Lineage for d1mkma1 (1mkm A:1-75)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.33: Transcriptional regulator IclR, N-terminal domain [74676] (1 protein)

6. Protein Transcriptional regulator IclR, N-terminal domain [74677] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [74678] (1 PDB entry)

8. Domain d1mkma1: 1mkm A:1-75 [79242]
   Other proteins in same PDB: d1mkma2, d1mkmb2
   complexed with fmt, zn

Details for d1mkma1

PDB Entry: 1mkm, 2.2 Å

PDB Description: crystal structure of the thermotoga maritima iclr

PDB Compounds: (A:) IclR transcriptional regulator

SCOPe Domain Sequences for d1mkma1:

Sequence; same for both SEQRES and ATOM records:

>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkryvp
gyklieygsfvlrrf

Timeline for d1mkma1:

• d1mkma1 first appeared in SCOP 1.63
  
• d1mkma1 appears in SCOPe 2.04
  
• d1mkma1 appears in SCOPe 2.06
  
• d1mkma1 appears in the current release, SCOPe 2.08