SCOP 1.73: Domain d1mkka_: 1mkk A:

Lineage for d1mkka_ (1mkk A:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (15 PDB entries)

8. Domain d1mkka_: 1mkk A: [79240]

Details for d1mkka_

PDB Entry: 1mkk, 1.32 Å

PDB Description: disulfide deficient mutant of vascular endothelial growth factor a (c61a and c104a)

PDB Compounds: (A:) Vascular Endothelial Growth Factor A

SCOP Domain Sequences for d1mkka_:

Sequence; same for both SEQRES and ATOM records:

>d1mkka_ g.17.1.1 (A:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggcandeglecvptee
snitmqimrikphqgqhigemsflqhnkcearp

Timeline for d1mkka_:

• d1mkka_ first appeared in SCOP 1.63
  
• d1mkka_ appears in SCOP 1.71
  
• d1mkka_ appears in SCOP 1.75
  
• d1mkka_ appears in the current release, SCOPe 2.08