Lineage for d1mkha_ (1mkh A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2051462Family b.40.4.4: Myf domain [50277] (7 protein domains)
  6. 2051469Protein C-terminal domain of methionyl-tRNA synthetase, MetRS-CD [82102] (1 species)
  7. 2051470Species Pyrococcus abyssi [TaxId:29292] [82103] (1 PDB entry)
  8. 2051471Domain d1mkha_: 1mkh A: [79238]

Details for d1mkha_

PDB Entry: 1mkh (more details), 2.01 Å

PDB Description: C-terminal domain of methionyl-tRNA synthetase from Pyrococcus abyssi
PDB Compounds: (A:) C-terminal domain of Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1mkha_:

Sequence, based on SEQRES records: (download)

>d1mkha_ b.40.4.4 (A:) C-terminal domain of methionyl-tRNA synthetase, MetRS-CD {Pyrococcus abyssi [TaxId: 29292]}
myvkfddfakldlrvgkiievkdhpnadklyvvkvdlgdevrtlvaglkkyykpeellnr
yvvvvanlepkklrgigsqgmllaaddgervallmpdkevklgakvr

Sequence, based on observed residues (ATOM records): (download)

>d1mkha_ b.40.4.4 (A:) C-terminal domain of methionyl-tRNA synthetase, MetRS-CD {Pyrococcus abyssi [TaxId: 29292]}
myvkfddfakldlrvgkiievkdhpnadklyvvkvdlgdevrtlvaglkkyykpeellnr
yvvvvanlepkklgigsqgmllaaddgervallmpdkevklgakvr

SCOPe Domain Coordinates for d1mkha_:

Click to download the PDB-style file with coordinates for d1mkha_.
(The format of our PDB-style files is described here.)

Timeline for d1mkha_: