Lineage for d1mkfb_ (1mkf B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821450Fold b.116: Viral chemokine binding protein m3 [82045] (1 superfamily)
    consists of two different beta-sandwich domains of partial topological similarity to immunoglobulin-like folds
  4. 2821451Superfamily b.116.1: Viral chemokine binding protein m3 [82046] (1 family) (S)
    automatically mapped to Pfam PF09213
  5. 2821452Family b.116.1.1: Viral chemokine binding protein m3 [82047] (1 protein)
  6. 2821453Protein Viral chemokine binding protein m3 [82048] (1 species)
  7. 2821454Species Murid herpesvirus 4, MuHV-4 [TaxId:33708] [82049] (4 PDB entries)
  8. 2821456Domain d1mkfb_: 1mkf B: [79233]

Details for d1mkfb_

PDB Entry: 1mkf (more details), 2.1 Å

PDB Description: viral chemokine binding protein m3 from murine gammaherpesvirus 68
PDB Compounds: (B:) m3

SCOPe Domain Sequences for d1mkfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkfb_ b.116.1.1 (B:) Viral chemokine binding protein m3 {Murid herpesvirus 4, MuHV-4 [TaxId: 33708]}
hssgvstqsvdlsqikrgdeiqahcltpaetevtecagilkdvlsknlhelqglcnvknk
mgvpwvsveelgqeiitgrlpfpsvggtpvndlvrvlvvaesntpeetpeeefyayvelq
telytfglsddnvvftsdymtvwmidipksyvdvgmltratfleqwpgakvtvmipysst
ftwcgelgaiseesapqpslsarspvcknsarystskfcevdgctaetgmekmslltpfg
gppqqakmntcpcyykysvsplpamdhliladlagldsltspvyvmaayfdsthenpvrp
ssklyhcalqmtshdgvwtstsseqcpirlvegqsqnvlqvrvaptsmpnlvgvslmleg
qqyrleyfgdh

SCOPe Domain Coordinates for d1mkfb_:

Click to download the PDB-style file with coordinates for d1mkfb_.
(The format of our PDB-style files is described here.)

Timeline for d1mkfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mkfa_