![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins) |
![]() | Protein Actin regulatory protein WASP [82140] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [82141] (1 PDB entry) |
![]() | Domain d1mkea1: 1mke A:31-144 [79231] pseudo complex: fusion protein with a WIP peptide (res. 1-25) and a linker peptide (res. 26-30) |
PDB Entry: 1mke (more details)
SCOPe Domain Sequences for d1mkea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mkea1 b.55.1.4 (A:31-144) Actin regulatory protein WASP {Norway rat (Rattus norvegicus) [TaxId: 10116]} slfsflgkkcvtmssavvqlyaadrncmwskkcsgvaclvkdnpqrsyflrifdikdgkl lweqelynnfvynsprgyfhtfagdtcqvalnfaneeeakkfrkavtdllgrrq
Timeline for d1mkea1: