SCOPe 2.07: Domain d1mk9h2: 1mk9 H:309-400

Lineage for d1mk9h2 (1mk9 H:309-400)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.5: Third domain of FERM [50776] (8 proteins)

6. Protein Talin [82144] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [82145] (7 PDB entries)

8. Domain d1mk9h2: 1mk9 H:309-400 [79230]
   Other proteins in same PDB: d1mk9b1, d1mk9d1, d1mk9f1, d1mk9h1

Details for d1mk9h2

PDB Entry: 1mk9, 2.8 Å

PDB Description: crystal structure of an integrin beta3-talin chimera

PDB Compounds: (H:) Talin

SCOPe Domain Sequences for d1mk9h2:

Sequence, based on SEQRES records:

>d1mk9h2 b.55.1.5 (H:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]}
gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
dfgdyqdgyysvqttegeqiaqliagyidiil

Sequence, based on observed residues (ATOM records):

>d1mk9h2 b.55.1.5 (H:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]}
gvsfflvkeknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftldfgd
yqdgyysvqttegeqiaqliagyidiil

Timeline for d1mk9h2:

• d1mk9h2 first appeared in SCOP 1.63
  
• d1mk9h2 appears in SCOPe 2.06
  
• d1mk9h2 appears in the current release, SCOPe 2.08