SCOPe 2.06: Domain d1mk9h1: 1mk9 H:209-308

Lineage for d1mk9h1 (1mk9 H:209-308)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (2 families)
   automatically mapped to Pfam PF00373

5. Family a.11.2.1: Second domain of FERM [47032] (9 proteins)

6. Protein Talin [81716] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [81717] (5 PDB entries)

8. Domain d1mk9h1: 1mk9 H:209-308 [79229]
   Other proteins in same PDB: d1mk9b2, d1mk9d2, d1mk9f2, d1mk9h2
   chimera with an integrin beta3 peptide, chains A, C, E and G

Details for d1mk9h1

PDB Entry: 1mk9, 2.8 Å

PDB Description: crystal structure of an integrin beta3-talin chimera

PDB Compounds: (H:) Talin

SCOPe Domain Sequences for d1mk9h1:

Sequence; same for both SEQRES and ATOM records:

>d1mk9h1 a.11.2.1 (H:209-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]}
pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
eyikqkgerkifmahkncgnmseieakvryvklarslkty

Timeline for d1mk9h1:

• d1mk9h1 first appeared in SCOP 1.63
  
• d1mk9h1 appears in SCOPe 2.05
  
• d1mk9h1 appears in SCOPe 2.07
  
• d1mk9h1 appears in the current release, SCOPe 2.08