Class a: All alpha proteins [46456] (289 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (2 families) automatically mapped to Pfam PF00373 |
Family a.11.2.1: Second domain of FERM [47032] (9 proteins) |
Protein Talin [81716] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [81717] (5 PDB entries) |
Domain d1mk9h1: 1mk9 H:209-308 [79229] Other proteins in same PDB: d1mk9b2, d1mk9d2, d1mk9f2, d1mk9h2 chimera with an integrin beta3 peptide, chains A, C, E and G |
PDB Entry: 1mk9 (more details), 2.8 Å
SCOPe Domain Sequences for d1mk9h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mk9h1 a.11.2.1 (H:209-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk eyikqkgerkifmahkncgnmseieakvryvklarslkty
Timeline for d1mk9h1: