| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (1 family) ![]() |
| Family a.11.2.1: Second domain of FERM [47032] (6 proteins) |
| Protein Talin [81716] (1 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [81717] (4 PDB entries) |
| Domain d1mk9h1: 1mk9 H:209-308 [79229] Other proteins in same PDB: d1mk9b2, d1mk9d2, d1mk9f2, d1mk9h2 chimera with an integrin beta3 peptide, chains A, C, E and G |
PDB Entry: 1mk9 (more details), 2.8 Å
SCOP Domain Sequences for d1mk9h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mk9h1 a.11.2.1 (H:209-308) Talin {Chicken (Gallus gallus)}
pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
eyikqkgerkifmahkncgnmseieakvryvklarslkty
Timeline for d1mk9h1: