Lineage for d1mk9f2 (1mk9 F:309-398)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467364Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 467365Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 467569Family b.55.1.5: Third domain of FERM [50776] (6 proteins)
  6. 467596Protein Talin [82144] (1 species)
  7. 467597Species Chicken (Gallus gallus) [TaxId:9031] [82145] (4 PDB entries)
  8. 467604Domain d1mk9f2: 1mk9 F:309-398 [79228]
    Other proteins in same PDB: d1mk9b1, d1mk9d1, d1mk9f1, d1mk9h1

Details for d1mk9f2

PDB Entry: 1mk9 (more details), 2.8 Å

PDB Description: crystal structure of an integrin beta3-talin chimera

SCOP Domain Sequences for d1mk9f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mk9f2 b.55.1.5 (F:309-398) Talin {Chicken (Gallus gallus)}
gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
dfgdyqdgyysvqttegeqiaqliagyidi

SCOP Domain Coordinates for d1mk9f2:

Click to download the PDB-style file with coordinates for d1mk9f2.
(The format of our PDB-style files is described here.)

Timeline for d1mk9f2: